PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa08g051880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-other
Protein Properties Length: 926aa    MW: 102775 Da    PI: 8.4156
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa08g051880.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox17.19.6e-0666122157
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     +r+R  ++++  + L+++F+ +  +s++e +e+++  g+t +qV+ +F  ++++ +k
  Csa08g051880.1  66 KRPRDLLNPKAAKYLQAVFAVKDAISKRESREISALFGITVAQVRDFFVTQKTRVRK 122
                     799*********************************************999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.32963123IPR001356Homeobox domain
SMARTSM003894.9E-465127IPR001356Homeobox domain
SuperFamilySSF466892.69E-565125IPR009057Homeodomain-like
CDDcd000860.0069866123No hitNo description
Gene3DG3DSA:1.10.10.601.8E-466125IPR009057Homeodomain-like
Gene3DG3DSA:1.20.930.102.6E-5228322IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476767.32E-6231324IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 926 aa     Download sequence    Send to blast
MDAFNDEIEI GSSVESLMEL LDSQKELFHS QIDQLQDVVV AQCKLTGVNP LAQEMAAGAL  60
SIKIGKRPRD LLNPKAAKYL QAVFAVKDAI SKRESREISA LFGITVAQVR DFFVTQKTRV  120
RKQVRLSREK LILSNSDALQ GDGVTENNNA TNHVDPVPLN SVHPEACSLS WGEGETVALM  180
PPEDIPPDIS DSDKYFVENI FSLLRKEETF SGQVKLMEWI MQIQDSSVLI WFLSKGGVLI  240
LTTWLSQAAA EEQTSVLLLI LKVLCHLPLH KASPENMSAI LQSVNGLRFY RTSDISNRAK  300
GLLSRWTKLF AKIQAMKKQN RNNSQIDSQS QLLLKQSIAE IMGDTSNPED ILSLTNGRSE  360
NVRRFESSQG PKLLLTSADD STKKHMLGST PSYNKERRKV QMVEQPGQKA AGKSPQTVRI  420
GTSIRSRPMS ADDIQKAKMR ALYMQSKNSK KDALPSAIGD SKTIVPEKPL ALQSSKDFPP  480
SQNSEAKTED TNVPSAIQPV DGPAIIVPIQ TDEIKKPFLT PSKSISNKVG ILVKMSPQTI  540
LKNCKRIQID WHVPPGMELD EAWRVAAGGN SKEADVQRNR NRRERETTYQ SLQTIPLNPK  600
EPWDREMDYD DSLTPEIPSQ QSPEESSTEP QESLDERRTA AGAATTSSSL SCPEPDLELL  660
AALLKNPDLV YALTSGKPSN LGGQDMVKLL DVIKTGAPTS SSSSNKQVEE KVEVSLPSPT  720
PATNPGMSGW GQEAIRNPFS RQNQVGAAVA RSGTHLHVTS MQWQSTNEQA IPRHATAAYN  780
NSLILSHTER QQQQQQQQQQ QQMQPQLHHN HHLQQQPIST TSYAVREAVG QMGTATSSGS  840
WRSQQSQNSY YSHQGNEIAV ASQASSYQGN NQYMSSDRGY ESWSPDHSPS RNHPNVRGQQ  900
QQQQQPSRKY DSSSHPYWNQ NKRWR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2267460.0AK226746.1 Arabidopsis thaliana mRNA for luminidependens protein, complete cds, clone: RAFL07-75-C15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010422575.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLD7M3G50.0D7M3G5_ARALL; Putative uncharacterized protein
STRINGscaffold_604015.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein